Lineage for d1jm7b_ (1jm7 B:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1706894Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1706895Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1706896Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 1706903Protein bard1 RING domain [69970] (1 species)
  7. 1706904Species Human (Homo sapiens) [TaxId:9606] [69971] (1 PDB entry)
  8. 1706905Domain d1jm7b_: 1jm7 B: [66881]
    Other proteins in same PDB: d1jm7a_
    heterodimer with brca1 RING domain
    complexed with zn

Details for d1jm7b_

PDB Entry: 1jm7 (more details)

PDB Description: solution structure of the brca1/bard1 ring-domain heterodimer
PDB Compounds: (B:) brca1-associated ring domain protein 1

SCOPe Domain Sequences for d1jm7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}
mepdgrgawahsraaldrlekllrcsrctnilrepvclggcehifcsncvsdcigtgcpv
cytpawiqdlkinrqldsmiqlcsklrnllhdnelsd

SCOPe Domain Coordinates for d1jm7b_:

Click to download the PDB-style file with coordinates for d1jm7b_.
(The format of our PDB-style files is described here.)

Timeline for d1jm7b_: