Lineage for d1jl3a_ (1jl3 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2482762Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2482763Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2482764Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2482765Protein Arsenate reductase ArsC [69504] (3 species)
    also has a phosphotyrosine phosphatase activity
  7. 2482771Species Bacillus subtilis [TaxId:1423] [69506] (3 PDB entries)
  8. 2482772Domain d1jl3a_: 1jl3 A: [66826]
    complexed with so4

Details for d1jl3a_

PDB Entry: 1jl3 (more details), 1.6 Å

PDB Description: crystal structure of b. subtilis arsc
PDB Compounds: (A:) arsenate reductase

SCOPe Domain Sequences for d1jl3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl3a_ c.44.1.1 (A:) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]}
nkiiyflctgnscrsqmaegwakqylgdewkvysagieahglnpnavkamkevgidisnq
tsdiidsdilnnadlvvtlcgdaadkcpmtpphvkrehwgfddparaqgteeekwaffqr
vrdeignrlkefaetgk

SCOPe Domain Coordinates for d1jl3a_:

Click to download the PDB-style file with coordinates for d1jl3a_.
(The format of our PDB-style files is described here.)

Timeline for d1jl3a_: