Lineage for d1jkjb1 (1jkj B:239-388)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856236Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2856237Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2856295Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species)
  7. 2856296Species Escherichia coli [TaxId:562] [52216] (11 PDB entries)
  8. 2856301Domain d1jkjb1: 1jkj B:239-388 [66802]
    Other proteins in same PDB: d1jkja1, d1jkja2, d1jkjb2, d1jkjd1, d1jkjd2, d1jkje2
    complexed with coa, gol, po4, so4

Details for d1jkjb1

PDB Entry: 1jkj (more details), 2.35 Å

PDB Description: E. coli SCS
PDB Compounds: (B:) succinyl-CoA synthetase beta subunit

SCOPe Domain Sequences for d1jkjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkjb1 c.23.4.1 (B:239-388) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaavegk

SCOPe Domain Coordinates for d1jkjb1:

Click to download the PDB-style file with coordinates for d1jkjb1.
(The format of our PDB-style files is described here.)

Timeline for d1jkjb1: