Lineage for d1jkja1 (1jkj A:1-121)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106576Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 2106594Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (5 species)
  7. 2106597Species Escherichia coli [TaxId:562] [51902] (11 PDB entries)
  8. 2106602Domain d1jkja1: 1jkj A:1-121 [66800]
    Other proteins in same PDB: d1jkja2, d1jkjb1, d1jkjb2, d1jkjd2, d1jkje1, d1jkje2
    complexed with coa, gol, po4, so4

Details for d1jkja1

PDB Entry: 1jkj (more details), 2.35 Å

PDB Description: E. coli SCS
PDB Compounds: (A:) succinyl-CoA synthetase alpha subunit

SCOPe Domain Sequences for d1jkja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkja1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOPe Domain Coordinates for d1jkja1:

Click to download the PDB-style file with coordinates for d1jkja1.
(The format of our PDB-style files is described here.)

Timeline for d1jkja1: