![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
![]() | Protein Copper chaperone for superoxide dismutase, N-terminal domain [55019] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55020] (2 PDB entries) |
![]() | Domain d1jk9b2: 1jk9 B:3-73 [63151] Other proteins in same PDB: d1jk9a_, d1jk9b1, d1jk9c_, d1jk9d1 complexed with so4, zn |
PDB Entry: 1jk9 (more details), 2.9 Å
SCOPe Domain Sequences for d1jk9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jk9b2 d.58.17.1 (B:3-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tndtyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintlr ncgkdaiirga
Timeline for d1jk9b2:
![]() Domains from other chains: (mouse over for more information) d1jk9a_, d1jk9c_, d1jk9d1, d1jk9d2 |