Lineage for d1jjva_ (1jjv A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123551Protein Dephospho-CoA kinase [75187] (4 species)
  7. 2123568Species Haemophilus influenzae [TaxId:727] [75188] (1 PDB entry)
  8. 2123569Domain d1jjva_: 1jjv A: [71698]
    complexed with atp, hg, so4

Details for d1jjva_

PDB Entry: 1jjv (more details), 2 Å

PDB Description: dephospho-coa kinase in complex with atp
PDB Compounds: (A:) dephospho-coa kinase

SCOPe Domain Sequences for d1jjva_:

Sequence, based on SEQRES records: (download)

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}
mtyivgltggigsgkttianlftdlgvplvdadvvarevvakdspllskivehfgaqilt
eqgelnraalrervfnhdedklwlnnllhpairermkqklaeqtapytlfvvpllienkl
talcdrilvvdvspqtqlarsaqrdnnnfeqiqrimnsqvsqqerlkwaddvinndaela
qnlphlqqkvlelhqfylqqaenkn

Sequence, based on observed residues (ATOM records): (download)

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}
mtyivgltggigsgkttianlftdlgvplvdadvvarevvakdspllskivehfgaqiln
raalrervfnhdedklwlnnllhpairermkqklaeqtapytlfvvpllienkltalcdr
ilvvdvspqtqlarsanfeqiqrimnsqvsqqerlkwaddvinndaelaqnlphlqqkvl
elhqfylqqaenkn

SCOPe Domain Coordinates for d1jjva_:

Click to download the PDB-style file with coordinates for d1jjva_.
(The format of our PDB-style files is described here.)

Timeline for d1jjva_: