| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
| Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
| Protein Zn metallo-beta-lactamase [56283] (12 species) |
| Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (7 PDB entries) |
| Domain d1jjeb_: 1jje B: [63118] complexed with act, bys, zn |
PDB Entry: 1jje (more details), 1.8 Å
SCOPe Domain Sequences for d1jjeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjeb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
twfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
kllkskygkaklvvpshsevgdasllkltleqavkglnesk
Timeline for d1jjeb_: