Lineage for d1jjeb_ (1jje B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440053Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1440054Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1440055Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1440056Protein Zn metallo-beta-lactamase [56283] (11 species)
  7. 1440126Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (4 PDB entries)
  8. 1440130Domain d1jjeb_: 1jje B: [63118]
    complexed with act, bys, zn

Details for d1jjeb_

PDB Entry: 1jje (more details), 1.8 Å

PDB Description: imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a biaryl succinic acid inhibitor (11)
PDB Compounds: (B:) imp-1 metallo beta-lactamase

SCOPe Domain Sequences for d1jjeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjeb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
twfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
kllkskygkaklvvpshsevgdasllkltleqavkglnesk

SCOPe Domain Coordinates for d1jjeb_:

Click to download the PDB-style file with coordinates for d1jjeb_.
(The format of our PDB-style files is described here.)

Timeline for d1jjeb_: