SCOPe 2.04: Domain d1jjcb6: 1jjc B:191-399

Lineage for d1jjcb6 (1jjc B:191-399)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.153: PheT/TilS domain [56036] (1 superfamily)
core: 3 layers; contains beta-sandwich of unusual topology
Superfamily b.153.1: PheT/TilS domain [56037] (2 families)
contains putative tRNA-binding structural motif
Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
Pfam PF03483; decorated with additional structures
Protein B3/B4 domain of PheRS, PheT [56039] (1 species)
Species Thermus thermophilus [TaxId:274] [56040] (11 PDB entries)
identical sequence to Thermus aquaticus, TaxId: 271
Domain d1jjcb6: 1jjc B:191-399 [66764]
Other proteins in same PDB: d1jjca_, d1jjcb1, d1jjcb2, d1jjcb3, d1jjcb4, d1jjcb5
protein/RNA complex; complexed with fa5, mn, so4

Details for d1jjcb6

PDB Entry: 1jjc (more details), 2.6 Å

PDB Description: Crystal structure at 2.6A resolution of phenylalanyl-tRNA synthetase complexed with phenylalanyl-adenylate in the presence of manganese

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d1jjcb6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjcb6 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

SCOPe Domain Coordinates for d1jjcb6:

Click to download the PDB-style file with coordinates for d1jjcb6.
(The format of our PDB-style files is described here.)

Timeline for d1jjcb6: