SCOPe 2.04: Domain d1jjcb5: 1jjc B:475-681

Lineage for d1jjcb5 (1jjc B:475-681)

Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheet
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
this domain is non-catalytic
Species Thermus thermophilus [TaxId:274] [55704] (11 PDB entries)
identical sequence to Thermus aquaticus, TaxId: 271
Domain d1jjcb5: 1jjc B:475-681 [66763]
Other proteins in same PDB: d1jjca_, d1jjcb1, d1jjcb2, d1jjcb3, d1jjcb4, d1jjcb6
protein/RNA complex; complexed with fa5, mn, so4

Details for d1jjcb5

PDB Entry: 1jjc (more details), 2.6 Å

PDB Description: Crystal structure at 2.6A resolution of phenylalanyl-tRNA synthetase complexed with phenylalanyl-adenylate in the presence of manganese

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d1jjcb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjcb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOPe Domain Coordinates for d1jjcb5:

Click to download the PDB-style file with coordinates for d1jjcb5.
(The format of our PDB-style files is described here.)

Timeline for d1jjcb5: