Lineage for d1jjcb3 (1jjc B:39-151)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541449Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 1541459Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
  7. 1541460Species Thermus thermophilus [TaxId:274] [50279] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1541461Domain d1jjcb3: 1jjc B:39-151 [66761]
    Other proteins in same PDB: d1jjca_, d1jjcb1, d1jjcb2, d1jjcb4, d1jjcb5, d1jjcb6
    protein/RNA complex; complexed with fa5, mn, so4

Details for d1jjcb3

PDB Entry: 1jjc (more details), 2.6 Å

PDB Description: Crystal structure at 2.6A resolution of phenylalanyl-tRNA synthetase complexed with phenylalanyl-adenylate in the presence of manganese
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d1jjcb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjcb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOPe Domain Coordinates for d1jjcb3:

Click to download the PDB-style file with coordinates for d1jjcb3.
(The format of our PDB-style files is described here.)

Timeline for d1jjcb3: