SCOPe 2.04: Domain d1jjcb2: 1jjc B:400-474

Lineage for d1jjcb2 (1jjc B:400-474)

Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds)
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)
Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
duplication: contains two such domains related by pseudo dyad
Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
Species Thermus thermophilus [TaxId:274] [46958] (11 PDB entries)
identical sequence to Thermus aquaticus, TaxId: 271
Domain d1jjcb2: 1jjc B:400-474 [66760]
Other proteins in same PDB: d1jjca_, d1jjcb3, d1jjcb4, d1jjcb5, d1jjcb6
protein/RNA complex; complexed with fa5, mn, so4

Details for d1jjcb2

PDB Entry: 1jjc (more details), 2.6 Å

PDB Description: Crystal structure at 2.6A resolution of phenylalanyl-tRNA synthetase complexed with phenylalanyl-adenylate in the presence of manganese

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d1jjcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjcb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

SCOPe Domain Coordinates for d1jjcb2:

Click to download the PDB-style file with coordinates for d1jjcb2.
(The format of our PDB-style files is described here.)

Timeline for d1jjcb2: