Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) automatically mapped to Pfam PF00297 |
Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries) Uniprot P20279 |
Domain d1jj2b_: 1jj2 B: [63086] Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_ complexed with cd, cl, k, mg, na |
PDB Entry: 1jj2 (more details), 2.4 Å
SCOPe Domain Sequences for d1jj2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jj2b_ b.43.3.2 (B:) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]} pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg
Timeline for d1jj2b_:
View in 3D Domains from other chains: (mouse over for more information) d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_ |