Lineage for d1jiwi_ (1jiw I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2806532Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families) (S)
  5. 2806533Family b.61.2.1: Metalloprotease inhibitor [50883] (1 protein)
    automatically mapped to Pfam PF02974
  6. 2806534Protein Metalloprotease inhibitor [50884] (2 species)
  7. 2806537Species Pseudomonas aeruginosa, aprin [TaxId:287] [63813] (1 PDB entry)
  8. 2806538Domain d1jiwi_: 1jiw I: [63078]
    Other proteins in same PDB: d1jiwp1, d1jiwp2
    complexed with ca, zn

Details for d1jiwi_

PDB Entry: 1jiw (more details), 1.74 Å

PDB Description: Crystal structure of the APR-APRin complex
PDB Compounds: (I:) proteinase inhibitor

SCOPe Domain Sequences for d1jiwi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiwi_ b.61.2.1 (I:) Metalloprotease inhibitor {Pseudomonas aeruginosa, aprin [TaxId: 287]}
sslillsasdlagqwtlqqdeapaichlelrdsevaeasgydlggdtacltrwlpsepra
wrptpagiallerggltlmllgrqgegdyrvqkgdggqlvlrrat

SCOPe Domain Coordinates for d1jiwi_:

Click to download the PDB-style file with coordinates for d1jiwi_.
(The format of our PDB-style files is described here.)

Timeline for d1jiwi_: