Lineage for d1jiga_ (1jig A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1084174Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1084505Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1084518Species Bacillus anthracis, Dlp-2 [TaxId:1392] [74706] (1 PDB entry)
  8. 1084519Domain d1jiga_: 1jig A: [71685]
    complexed with fe

Details for d1jiga_

PDB Entry: 1jig (more details), 1.46 Å

PDB Description: Dlp-2 from Bacillus anthracis
PDB Compounds: (A:) Dlp-2

SCOPe Domain Sequences for d1jiga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiga_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-2 [TaxId: 1392]}
stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
atsadmllaihttleqhvwmlsaflk

SCOPe Domain Coordinates for d1jiga_:

Click to download the PDB-style file with coordinates for d1jiga_.
(The format of our PDB-style files is described here.)

Timeline for d1jiga_: