Lineage for d1jida_ (1jid A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006116Fold d.201: SRP19 [69694] (1 superfamily)
    beta-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 3006117Superfamily d.201.1: SRP19 [69695] (2 families) (S)
    automatically mapped to Pfam PF01922
  5. 3006118Family d.201.1.1: SRP19 [69696] (1 protein)
  6. 3006119Protein SRP19 [69697] (3 species)
  7. 3006123Species Human (Homo sapiens) [TaxId:9606] [69698] (4 PDB entries)
  8. 3006124Domain d1jida_: 1jid A: [66735]
    protein/RNA complex; complexed with mg

Details for d1jida_

PDB Entry: 1jid (more details), 1.8 Å

PDB Description: human srp19 in complex with helix 6 of human srp rna
PDB Compounds: (A:) signal recognition particle 19 kda protein

SCOPe Domain Sequences for d1jida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jida_ d.201.1.1 (A:) SRP19 {Human (Homo sapiens) [TaxId: 9606]}
aarspadqdrficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvflek
nkmysrewnrdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktr

SCOPe Domain Coordinates for d1jida_:

Click to download the PDB-style file with coordinates for d1jida_.
(The format of our PDB-style files is described here.)

Timeline for d1jida_: