Lineage for d1jiaa_ (1jia A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
common core: 2 helices, disulfide-linked, and a calcium-binding loopSuperfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
automatically mapped to Pfam PF00068Protein Snake phospholipase A2 [48624] (36 species) 
Species Halys viper (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries) 
Domain d1jiaa_: 1jia A: [19528]
complexed with ca
Details for d1jiaa_
PDB Entry: 1jia (more details), 2.13 Å
PDB Description: structure of a basic phospholipase a2 from agkistrodon halys pallas at 2.13a resolution
PDB Compounds: (A:) phospholipase a2SCOPe Domain Sequences for d1jiaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jiaa_ a.133.1.2 (A:) Snake phospholipase A2 {Halys viper (Agkistrodon halys) [TaxId: 8714]}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc
SCOPe Domain Coordinates for d1jiaa_:
Click to download the PDB-style file with coordinates for d1jiaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jiaa_:
- d1jiaa_ first appeared (with stable ids) in SCOP 1.55
- d1jiaa_ appears in SCOPe 2.04
- d1jiaa_ appears in SCOPe 2.06
- d1jiaa_ appears in the current release, SCOPe 2.08
View in 3D
