Lineage for d1ji0a_ (1ji0 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2127048Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2127058Protein Branched chain aminoacid ABC transporter [75207] (1 species)
  7. 2127059Species Thermotoga maritima, TM1139 [TaxId:2336] [75208] (1 PDB entry)
  8. 2127060Domain d1ji0a_: 1ji0 A: [71665]
    complexed with atp

Details for d1ji0a_

PDB Entry: 1ji0 (more details), 2 Å

PDB Description: crystal structure analysis of the abc transporter from thermotoga maritima
PDB Compounds: (A:) ABC transporter

SCOPe Domain Sequences for d1ji0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}
mvsdivlevqslhvyygaihaikgidlkvprgqivtligangagktttlsaiaglvraqk
gkiifngqditnkpahvinrmgialvpegrrifpeltvyenlmmgaynrkdkegikrdle
wifslfprlkerlkqlggtlsggeqqmlaigralmsrpkllmmdepslglapilvsevfe
viqkinqegttillveqnalgalkvahygyvletgqivlegkaselldnemvrkaylgva

SCOPe Domain Coordinates for d1ji0a_:

Click to download the PDB-style file with coordinates for d1ji0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ji0a_: