Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
Protein Branched chain aminoacid ABC transporter [75207] (1 species) |
Species Thermotoga maritima, TM1139 [TaxId:2336] [75208] (1 PDB entry) |
Domain d1ji0a_: 1ji0 A: [71665] complexed with atp |
PDB Entry: 1ji0 (more details), 2 Å
SCOPe Domain Sequences for d1ji0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} mvsdivlevqslhvyygaihaikgidlkvprgqivtligangagktttlsaiaglvraqk gkiifngqditnkpahvinrmgialvpegrrifpeltvyenlmmgaynrkdkegikrdle wifslfprlkerlkqlggtlsggeqqmlaigralmsrpkllmmdepslglapilvsevfe viqkinqegttillveqnalgalkvahygyvletgqivlegkaselldnemvrkaylgva
Timeline for d1ji0a_: