Lineage for d1ji0a_ (1ji0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870132Protein Branched chain aminoacid ABC transporter [75207] (1 species)
  7. 2870133Species Thermotoga maritima, TM1139 [TaxId:2336] [75208] (1 PDB entry)
  8. 2870134Domain d1ji0a_: 1ji0 A: [71665]
    complexed with atp

Details for d1ji0a_

PDB Entry: 1ji0 (more details), 2 Å

PDB Description: crystal structure analysis of the abc transporter from thermotoga maritima
PDB Compounds: (A:) ABC transporter

SCOPe Domain Sequences for d1ji0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}
mvsdivlevqslhvyygaihaikgidlkvprgqivtligangagktttlsaiaglvraqk
gkiifngqditnkpahvinrmgialvpegrrifpeltvyenlmmgaynrkdkegikrdle
wifslfprlkerlkqlggtlsggeqqmlaigralmsrpkllmmdepslglapilvsevfe
viqkinqegttillveqnalgalkvahygyvletgqivlegkaselldnemvrkaylgva

SCOPe Domain Coordinates for d1ji0a_:

Click to download the PDB-style file with coordinates for d1ji0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ji0a_: