Lineage for d1jhfa1 (1jhf A:2-72)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1478547Family a.4.5.2: LexA repressor, N-terminal DNA-binding domain [46789] (1 protein)
    automatically mapped to Pfam PF01726
  6. 1478548Protein LexA repressor, N-terminal DNA-binding domain [46790] (1 species)
  7. 1478549Species Escherichia coli [TaxId:562] [46791] (4 PDB entries)
  8. 1478550Domain d1jhfa1: 1jhf A:2-72 [63057]
    Other proteins in same PDB: d1jhfa2, d1jhfb_
    complexed with so4; mutant

Details for d1jhfa1

PDB Entry: 1jhf (more details), 1.8 Å

PDB Description: lexa g85d mutant
PDB Compounds: (A:) lexa repressor

SCOPe Domain Sequences for d1jhfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]}
kaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivsg
asrgirllqee

SCOPe Domain Coordinates for d1jhfa1:

Click to download the PDB-style file with coordinates for d1jhfa1.
(The format of our PDB-style files is described here.)

Timeline for d1jhfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jhfa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jhfb_