Lineage for d1jhda1 (1jhd A:1-173)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.122: PUA domain-like [88696] (1 superfamily)
pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each otherSuperfamily b.122.1: PUA domain-like [88697] (14 families) 
Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
contains extra structures; some similarity to the PK beta-barrel domain
automatically mapped to Pfam PF14306Protein ATP sulfurylase N-terminal domain [63802] (5 species) Species Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId:35843] [69296] (1 PDB entry) 
Domain d1jhda1: 1jhd A:1-173 [66712]
Other proteins in same PDB: d1jhda2
complexed with br, so4
Details for d1jhda1
PDB Entry: 1jhd (more details), 1.7 Å
PDB Description: Crystal Structure of Bacterial ATP Sulfurylase from the Riftia pachyptila Symbiont
PDB Compounds: (A:) sulfate adenylyltransferaseSCOPe Domain Sequences for d1jhda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jhda1 b.122.1.3 (A:1-173) ATP sulfurylase N-terminal domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]}
mikpvgsdelkplfvydpeehhklsheaeslpsvvissqaagnavmmgagyfsplqgfmn
vadamgaaekmtlsdgsffpvpvlcllentdaigdakrialrdpnvegnpvlavmdieai
eevsdeqmavmtdkvyrttdmdhigvktfnsqgrvavsgpiqvlnfsyfqadf
SCOPe Domain Coordinates for d1jhda1:
Click to download the PDB-style file with coordinates for d1jhda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jhda1:
- d1jhda1 first appeared in SCOP 1.59
- d1jhda1 appears in SCOPe 2.06
- d1jhda1 appears in the current release, SCOPe 2.08
View in 3D
