Lineage for d1jgsa_ (1jgs A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693734Protein Multiple antibiotic resistance repressor, MarR [68970] (1 species)
  7. 2693735Species Escherichia coli [TaxId:562] [68971] (1 PDB entry)
  8. 2693736Domain d1jgsa_: 1jgs A: [66683]
    complexed with sal

Details for d1jgsa_

PDB Entry: 1jgs (more details), 2.3 Å

PDB Description: Multiple Antibiotic Resistance Repressor, MarR
PDB Compounds: (A:) multiple antibiotic resistance protein marr

SCOPe Domain Sequences for d1jgsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]}
lfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlcsircaacitpvelkkvlsv
dlgaltrmldrlvckgwverlpnpndkrgvlvklttggaaiceqchqlvgqdlhqeltkn
ltadevatleyllkkvlp

SCOPe Domain Coordinates for d1jgsa_:

Click to download the PDB-style file with coordinates for d1jgsa_.
(The format of our PDB-style files is described here.)

Timeline for d1jgsa_: