Lineage for d1jg0a_ (1jg0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972208Protein Thymidylate synthase [55833] (7 species)
  7. 2972223Species Escherichia coli [TaxId:562] [55834] (70 PDB entries)
  8. 2972267Domain d1jg0a_: 1jg0 A: [66659]
    complexed with ddt, ump

Details for d1jg0a_

PDB Entry: 1jg0 (more details), 2 Å

PDB Description: Crystal structure of Escherichia coli thymidylate synthase complexed with 2'-deoxyuridine-5'-monophosphate and N,O-didansyl-L-tyrosine
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1jg0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jg0a_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndatgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgahidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapva

SCOPe Domain Coordinates for d1jg0a_:

Click to download the PDB-style file with coordinates for d1jg0a_.
(The format of our PDB-style files is described here.)

Timeline for d1jg0a_: