Lineage for d1jfra_ (1jfr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900720Family c.69.1.16: Lipase [53555] (2 proteins)
  6. 2900721Protein Lipase [53556] (1 species)
  7. 2900722Species Streptomyces exfoliatus [TaxId:1905] [53557] (1 PDB entry)
  8. 2900723Domain d1jfra_: 1jfr A: [34724]

Details for d1jfra_

PDB Entry: 1jfr (more details), 1.9 Å

PDB Description: crystal structure of the streptomyces exfoliatus lipase at 1.9a resolution: a model for a family of platelet-activating factor acetylhydrolases
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d1jfra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]}
npyergpaptnasieasrgpyatsqtsvsslvasgfgggtiyyptstadgtfgavvispg
ftayqssiawlgprlasqgfvvftidtnttldqpdsrgrqllsaldyltqrssvrtrvda
trlgvmghsmggggsleaaksrtslkaaipltgwntdktwpelrtptlvvgadgdtvapv
athskpfyeslpgsldkaylelrgashftpntsdttiakysiswlkrfidsdtryeqflc
piprpsltiaeyrgtcphts

SCOPe Domain Coordinates for d1jfra_:

Click to download the PDB-style file with coordinates for d1jfra_.
(The format of our PDB-style files is described here.)

Timeline for d1jfra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jfrb_