Lineage for d1jfha1 (1jfh A:404-496)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domainFamily b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
this domain follows the catalytic beta/alpha barrel domainProtein Animal alpha-amylase [51024] (3 species) 
Species Pig (Sus scrofa) [TaxId:9823] [51025] (13 PDB entries) 
Domain d1jfha1: 1jfh A:404-496 [27762]
Other proteins in same PDB: d1jfha2
complexed with ca, cl, hg
Details for d1jfha1
PDB Entry: 1jfh (more details), 2.03 Å
PDB Description: structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 angstrom resolution
PDB Compounds: (A:) alpha-amylaseSCOPe Domain Sequences for d1jfha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfha1 b.71.1.1 (A:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
epfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl
SCOPe Domain Coordinates for d1jfha1:
Click to download the PDB-style file with coordinates for d1jfha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jfha1:
- d1jfha1 first appeared (with stable ids) in SCOP 1.55, called d1jfh_1
- d1jfha1 appears in SCOPe 2.07
View in 3D
