Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Stellacyanin [49539] (1 species) |
Species Cucumber (Cucumis sativus) [TaxId:3659] [49540] (1 PDB entry) |
Domain d1jera_: 1jer A: [23022] CASP2 complexed with cu |
PDB Entry: 1jer (more details), 1.6 Å
SCOPe Domain Sequences for d1jera_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} mqstvhivgdntgwsvpsspnfysqwaagktfrvgdslqfnfpanahnvhemetkqsfda cnfvnsdndvertspvierldelgmhyfvctvgthcsngqklsinvvaan
Timeline for d1jera_: