Lineage for d1jeha1 (1jeh A:1-160,A:283-355)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2849925Protein Dihydrolipoamide dehydrogenase, N- and C-terminal domain [418938] (8 species)
  7. 2849932Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419382] (2 PDB entries)
  8. 2849935Domain d1jeha1: 1jeh A:1-160,A:283-355 [62912]
    Other proteins in same PDB: d1jeha2, d1jeha3, d1jehb2, d1jehb3
    complexed with fad
    has additional insertions and/or extensions that are not grouped together

Details for d1jeha1

PDB Entry: 1jeh (more details), 2.4 Å

PDB Description: crystal structure of yeast e3, lipoamide dehydrogenase
PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1jeha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jeha1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase, N- and C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tinkshdvviigggpagyvaaikaaqlgfntacvekrgklggtclnvgcipskallnnsh
lfhqmhteaqkrgidvngdikinvanfqkakddavkqltggiellfkknkvtyykgngsf
edetkirvtpvdglegtvkedhildvkniivatgsevtpfXvgrrpyiaglgaekiglev
dkrgrlviddqfnskfphikvvgdvtfgpmlahkaeeegiaavemlktghghvn

SCOPe Domain Coordinates for d1jeha1:

Click to download the PDB-style file with coordinates for d1jeha1.
(The format of our PDB-style files is described here.)

Timeline for d1jeha1: