Lineage for d1jebd_ (1jeb D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687752Species Mouse (Mus musculus) [TaxId:10090] [68939] (1 PDB entry)
  8. 2687754Domain d1jebd_: 1jeb D: [66594]
    Other proteins in same PDB: d1jeba_, d1jebc_
    complexed with cmo, hem

Details for d1jebd_

PDB Entry: 1jeb (more details), 2.1 Å

PDB Description: Chimeric Human/Mouse Carbonmonoxy Hemoglobin (Human Zeta2 / Mouse Beta2)
PDB Compounds: (D:) hemoglobin beta-single chain

SCOPe Domain Sequences for d1jebd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jebd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Mouse (Mus musculus) [TaxId: 10090]}
vhltdaekaavsglwgkvnadevggealgrllvvypwtqryfdsfgdlssasaimgnakv
kahgkkvitafndglnhldslkgtfaslselhcdklhvdpenfrllgnmivivlghhlgk
dftpaaqaafqkvvagvaaalahkyh

SCOPe Domain Coordinates for d1jebd_:

Click to download the PDB-style file with coordinates for d1jebd_.
(The format of our PDB-style files is described here.)

Timeline for d1jebd_: