Lineage for d1jcqb_ (1jcq B:)
- Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds) 
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) 
Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) Species Human (Homo sapiens) [TaxId:9606] [69090] (17 PDB entries) 
Domain d1jcqb_: 1jcq B: [66505]
Other proteins in same PDB: d1jcqa_
complexed with 739, acy, fpp, suc, zn; mutant
Details for d1jcqb_
PDB Entry: 1jcq (more details), 2.3 Å
PDB Description: crystal structure of human protein farnesyltransferase complexed with farnesyl diphosphate and the peptidomimetic inhibitor l-739,750
PDB Compounds: (B:) protein farnesyltransferase, beta subunitSCOP Domain Sequences for d1jcqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jcqb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq
speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq
hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe
SCOP Domain Coordinates for d1jcqb_:
Click to download the PDB-style file with coordinates for d1jcqb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jcqb_:
- d1jcqb_ first appeared in SCOP 1.59
- d1jcqb_ appears in SCOP 1.71
- d1jcqb_ appears in SCOP 1.75
- d1jcqb_ appears in the current release, SCOPe 2.08
View in 3D
