Lineage for d1jcha1 (1jch A:455-551)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820770Fold b.101: Ribonuclease domain of colicin E3 [63839] (1 superfamily)
    twisted meander beta-sheet of 6 strands
  4. 2820771Superfamily b.101.1: Ribonuclease domain of colicin E3 [63840] (1 family) (S)
    automatically mapped to Pfam PF09000
  5. 2820772Family b.101.1.1: Ribonuclease domain of colicin E3 [63841] (2 proteins)
  6. 2820773Protein Ribonuclease domain of colicin E3 [63842] (1 species)
  7. 2820774Species Escherichia coli [TaxId:562] [63843] (3 PDB entries)
  8. 2820778Domain d1jcha1: 1jch A:455-551 [66491]
    Other proteins in same PDB: d1jcha2, d1jcha3, d1jchb_, d1jchc2, d1jchc3, d1jchd_
    protein/RNA complex; complexed with cit, gol

Details for d1jcha1

PDB Entry: 1jch (more details), 3.02 Å

PDB Description: Crystal Structure of Colicin E3 in Complex with its Immunity Protein
PDB Compounds: (A:) Colicin E3

SCOPe Domain Sequences for d1jcha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcha1 b.101.1.1 (A:455-551) Ribonuclease domain of colicin E3 {Escherichia coli [TaxId: 562]}
kgfkdyghdyhpapktenikglgdlkpgipktpkqngggkrkrwtgdkgrkiyewdsqhg
elegyrasdgqhlgsfdpktgnqlkgpdpkrnikkyl

SCOPe Domain Coordinates for d1jcha1:

Click to download the PDB-style file with coordinates for d1jcha1.
(The format of our PDB-style files is described here.)

Timeline for d1jcha1: