Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein cAMP-dependent PK, catalytic subunit [56116] (5 species) AGC group; PKA subfamily; serine/threonine kinase |
Species Mouse (Mus musculus) [TaxId:10090] [56119] (29 PDB entries) |
Domain d1jbpe_: 1jbp E: [62849] complexed with adp, oct |
PDB Entry: 1jbp (more details), 2.2 Å
SCOPe Domain Sequences for d1jbpe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jbpe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} gseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnh yamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggem fshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfa krvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadepiqiye kivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqr kveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
Timeline for d1jbpe_: