Lineage for d1jbob_ (1jbo B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2688957Protein Phycocyanin beta subunit [88940] (9 species)
  7. 2688992Species Synechococcus elongatus [TaxId:32046] [88968] (1 PDB entry)
  8. 2688993Domain d1jbob_: 1jbo B: [84151]
    Other proteins in same PDB: d1jboa_
    complexed with cyc

Details for d1jbob_

PDB Entry: 1jbo (more details), 1.45 Å

PDB Description: The 1.45A Three-Dimensional Structure of c-Phycocyanin from the Thermophylic Cyanobacterium Synechococcus elongatus
PDB Compounds: (B:) C-phycocyanin beta chain

SCOPe Domain Sequences for d1jbob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jbob_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus elongatus [TaxId: 32046]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

SCOPe Domain Coordinates for d1jbob_:

Click to download the PDB-style file with coordinates for d1jbob_.
(The format of our PDB-style files is described here.)

Timeline for d1jbob_: