Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) automatically mapped to Pfam PF02507 |
Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins) |
Protein Subunit III of photosystem I reaction centre, PsaF [81534] (1 species) |
Species Synechococcus elongatus [TaxId:32046] [81533] (1 PDB entry) |
Domain d1jb0f_: 1jb0 F: [62825] Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_ complexed with bcr, ca, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 1jb0 (more details), 2.5 Å
SCOPe Domain Sequences for d1jb0f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb0f_ f.23.16.1 (F:) Subunit III of photosystem I reaction centre, PsaF {Synechococcus elongatus [TaxId: 32046]} dvaglvpckdspafqkraaaavnttadpasgqkrferysqalcgedglphlvvdgrlsra gdflipsvlflyiagwigwvgrayliavrnsgeanekeiiidvplaikcmltgfawplaa lkelasgeltakdneitvspr
Timeline for d1jb0f_: