Lineage for d1jatb_ (1jat B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1406955Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1406965Species Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId:4932] [64241] (2 PDB entries)
  8. 1406966Domain d1jatb_: 1jat B: [62819]
    complexed with ubc13

Details for d1jatb_

PDB Entry: 1jat (more details), 1.6 Å

PDB Description: Mms2/Ubc13 Ubiquitin Conjugating Enzyme Complex
PDB Compounds: (B:) Ubiquitin-conjugating enzyme variant MMS2

SCOPe Domain Sequences for d1jatb_:

Sequence, based on SEQRES records: (download)

>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]}
skvprnfrlleelekgekgfgpescsygladsdditmtkwngtilgpphsnhenriysls
idcgpnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkema
tpankklrqpkegetf

Sequence, based on observed residues (ATOM records): (download)

>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]}
skvprnfrlleelekgekescsygladsdditmtkwngtilgpphsnhenriyslsidcg
pnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkematpan
kklrqpkegetf

SCOPe Domain Coordinates for d1jatb_:

Click to download the PDB-style file with coordinates for d1jatb_.
(The format of our PDB-style files is described here.)

Timeline for d1jatb_: