Lineage for d1jatb_ (1jat B:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (5 families) 
Family d.20.1.1: UBC-related [54496] (7 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) 
Species Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId:4932] [64241] (2 PDB entries) 
Domain d1jatb_: 1jat B: [62819]
complexed with ubc13
Details for d1jatb_
PDB Entry: 1jat (more details), 1.6 Å
PDB Description: Mms2/Ubc13 Ubiquitin Conjugating Enzyme Complex
PDB Compounds: (B:) Ubiquitin-conjugating enzyme variant MMS2SCOPe Domain Sequences for d1jatb_:
Sequence, based on SEQRES records: (download)
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]}
skvprnfrlleelekgekgfgpescsygladsdditmtkwngtilgpphsnhenriysls
idcgpnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkema
tpankklrqpkegetf
Sequence, based on observed residues (ATOM records): (download)
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]}
skvprnfrlleelekgekescsygladsdditmtkwngtilgpphsnhenriyslsidcg
pnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkematpan
kklrqpkegetf
SCOPe Domain Coordinates for d1jatb_:
Click to download the PDB-style file with coordinates for d1jatb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jatb_:
- d1jatb_ first appeared in SCOP 1.57
- d1jatb_ appears in SCOPe 2.02
- d1jatb_ appears in SCOPe 2.04
- d1jatb_ appears in the current release, SCOPe 2.08
View in 3D
