Lineage for d1jala1 (1jal A:1-278)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein YchF GTP-binding protein N-terminal domain [82410] (2 species)
Member of the Obg family of GTPases; contains an alpha-hairpin insert subdomainSpecies Haemophilus influenzae [TaxId:727] [89666] (1 PDB entry)
HI0393
Domain d1jala1: 1jal A:1-278 [84138]
Other proteins in same PDB: d1jala2, d1jalb2
structural genomics
Details for d1jala1
PDB Entry: 1jal (more details), 2.4 Å
PDB Description: ychf protein (hi0393)
PDB Compounds: (A:) YchF proteinSCOPe Domain Sequences for d1jala1:
Sequence, based on SEQRES records: (download)
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]}
mgfkcgivglpnvgkstlfnaltkagieaanypfctiepntgvvpmpdprldalaeivkp
erilpttmefvdiaglvagaskgeglgnkflaniretdaighvvrcfenddivhvagkid
plddidtintelaladldsceraiqrlqkrakggdkeakfelsvmekilpvlenagmirs
vgldkeelqaiksynfltlkptmyianvnedgfennpyldrvreiaakegavvvpvcaai
eseiaelddeekveflqdlgieepglnrviragyalln
Sequence, based on observed residues (ATOM records): (download)
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]}
mgfkcgivglpnvgkstlfnaltkagpfctiepntgvvpmpdprldalaeivkperilpt
tmefvdiaglvagaskgeglgnkflaniretdaighvvrcfenidplddidtintelala
dldsceraiqrlqkrakggdkeakfelsvmekilpvlenagmirsvgldkeelqaiksyn
fltlkptmyianvnedgfennpyldrvreiaakegavvvpvcaaieseiaelddeekvef
lqdlgieepglnrviragyalln
SCOPe Domain Coordinates for d1jala1:
Click to download the PDB-style file with coordinates for d1jala1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jala1:
- d1jala1 first appeared in SCOP 1.65
- d1jala1 appears in SCOPe 2.02
- d1jala1 appears in SCOPe 2.04
- d1jala1 appears in the current release, SCOPe 2.08
View in 3D
