Lineage for d1jaka1 (1jak A:151-506)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
Glycosyl hydrolase family 20, GH20
automatically mapped to Pfam PF00728Protein beta-N-acetylhexosaminidase [63915] (1 species) Species Streptomyces plicatus [TaxId:1922] [63916] (6 PDB entries) 
Domain d1jaka1: 1jak A:151-506 [66472]
Other proteins in same PDB: d1jaka2
complexed with cl, gol, ifg, so4
Details for d1jaka1
PDB Entry: 1jak (more details), 1.75 Å
PDB Description: Streptomyces plicatus beta-N-acetylhexosaminidase in Complex with (2R,3R,4S,5R)-2-acetamido-3,4-dihydroxy-5-hydroxymethyl-piperidinium chloride (IFG)
PDB Compounds: (A:) beta-n-acetylhexosaminidaseSCOPe Domain Sequences for d1jaka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]}
yawrsamldvsrhffgvdevkryidrvarykynklhlhlsddqgwriaidswprlatygg
stevgggpggyytkaeykeivryaasrhlevvpeidmpghtnaalasyaelncdgvappl
ytgtkvgfsslcvdkdvtydfvddvigelaaltpgrylhiggdeahstpkadfvafmkrv
qpivakygktvvgwhqlagaepvegalvqywgldrtgdaekaevaeaarngtglilspad
rtyldmkytkdtplglswagyvevqrsydwdpagylpgapadavrgveaplwtetlsdpd
qldymafprlpgvaelgwspasthdwdtykvrlaaqapyweaagidfyrspqvpwt
SCOPe Domain Coordinates for d1jaka1:
Click to download the PDB-style file with coordinates for d1jaka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jaka1:
- d1jaka1 first appeared in SCOP 1.59
- d1jaka1 appears in SCOPe 2.03
- d1jaka1 appears in SCOPe 2.05
- d1jaka1 appears in the current release, SCOPe 2.08
View in 3D
