Lineage for d1jaga_ (1jag A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865878Protein Deoxyguanosine kinase [69480] (1 species)
  7. 2865879Species Human (Homo sapiens) [TaxId:9606] [69481] (2 PDB entries)
  8. 2865888Domain d1jaga_: 1jag A: [302565]
    automated match to d2ocpa_
    complexed with atp
    has additional insertions and/or extensions that are not grouped together

Details for d1jaga_

PDB Entry: 1jag (more details), 2.8 Å

PDB Description: Crystal Structure of Human Deoxyguanosine Kinase
PDB Compounds: (A:) deoxyguanosine kinase

SCOPe Domain Sequences for d1jaga_:

Sequence, based on SEQRES records: (download)

>d1jaga_ c.37.1.1 (A:) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}
gprrlsiegniavgkstfvklltktypewhvatepvatwqniqaagnqkactaqslgnll
dmmyreparwsytfqtfsflsrlkvqlepfpekllqarkpvqifersvysdryifaknlf
engslsdiewhiyqdwhsfllwefasritlhgfiylqaspqvclkrlyqrareeekgiel
ayleqlhgqheawlihkttklhfealmnipvlvldvnddfseevtkqedlmrevntfvkn
l

Sequence, based on observed residues (ATOM records): (download)

>d1jaga_ c.37.1.1 (A:) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}
gprrlsiegniavgkstfvklltktypewhvatepvatwqniqlgnlldmmyreparwsy
tfqtfsflsrlkvqlepfpekllqarkpvqifersvysdryifaknlfengslsdiewhi
yqdwhsfllwefasritlhgfiylqaspqvclkrlyqrareeekgielayleqlhgqhea
wlihkttklhfealmnipvlvldvnddfseevtkqedlmrevntfvknl

SCOPe Domain Coordinates for d1jaga_:

Click to download the PDB-style file with coordinates for d1jaga_.
(The format of our PDB-style files is described here.)

Timeline for d1jaga_: