Lineage for d1j9ct2 (1j9c T:107-210)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2035780Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2035781Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
    Uniprot P13726 33-242
  8. 2035846Domain d1j9ct2: 1j9c T:107-210 [103845]
    Other proteins in same PDB: d1j9ch_, d1j9cl1, d1j9cl2
    complexed with 0z6, ca, ful, glc, nag

Details for d1j9ct2

PDB Entry: 1j9c (more details), 2.9 Å

PDB Description: crystal structure of tissue factor-factor viia complex
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1j9ct2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9ct2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

SCOPe Domain Coordinates for d1j9ct2:

Click to download the PDB-style file with coordinates for d1j9ct2.
(The format of our PDB-style files is described here.)

Timeline for d1j9ct2:

2035846
d1j9ct2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1j9ct1