Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries) Uniprot P13726 33-242 |
Domain d1j9ct1: 1j9c T:1-106 [103844] Other proteins in same PDB: d1j9ch_, d1j9cl1, d1j9cl2 complexed with 0z6, ca, ful, glc, nag |
PDB Entry: 1j9c (more details), 2.9 Å
SCOPe Domain Sequences for d1j9ct1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9ct1 b.1.2.1 (T:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt deivkdvkqtylarvfsypagnvestgsageplyenspeftpylet
Timeline for d1j9ct1: