SCOPe 2.08: Domain d1j8hd1: 1j8h D:1-117

Lineage for d1j8hd1 (1j8h D:1-117)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries)
Domain d1j8hd1: 1j8h D:1-117 [71606]
Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd2, d1j8he2
complexed with nag

Details for d1j8hd1

PDB Entry: 1j8h (more details), 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4

PDB Compounds: (D:) T-cell receptor alpha chain

SCOPe Domain Sequences for d1j8hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
qsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgin
gfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipn

SCOPe Domain Coordinates for d1j8hd1:

Click to download the PDB-style file with coordinates for d1j8hd1.
(The format of our PDB-style files is described here.)

Timeline for d1j8hd1: