| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.222: YbaB-like [82606] (1 superfamily) core: alpha-beta(3)-alpha, 2 layers:alpha/beta, three-stranded antiparallel beta sheet, strand order 123 |
Superfamily d.222.1: YbaB-like [82607] (1 family) ![]() forms tight dimer of a 3-layer structure: beta/alpha/beta |
| Family d.222.1.1: YbaB-like [82608] (2 proteins) Pfam PF02575; DUF149; function unknown |
| Protein Hypothetical protein HI0442 [82609] (1 species) |
| Species Haemophilus influenzae [TaxId:727] [82610] (1 PDB entry) |
| Domain d1j8ba_: 1j8b A: [77101] structural genomics CASP4 complexed with mse |
PDB Entry: 1j8b (more details), 1.75 Å
SCOP Domain Sequences for d1j8ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j8ba_ d.222.1.1 (A:) Hypothetical protein HI0442 {Haemophilus influenzae [TaxId: 727]}
lgglmkqaqqmqekmqkmqeeiaqlevtgesgaglvkitingahncrrididpslmeddk
emledliaaafndavrraeelqkekmasvtag
Timeline for d1j8ba_: