Lineage for d1j8ba_ (1j8b A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880816Fold d.222: YbaB-like [82606] (1 superfamily)
    core: alpha-beta(3)-alpha, 2 layers:alpha/beta, three-stranded antiparallel beta sheet, strand order 123
  4. 880817Superfamily d.222.1: YbaB-like [82607] (1 family) (S)
    forms tight dimer of a 3-layer structure: beta/alpha/beta
  5. 880818Family d.222.1.1: YbaB-like [82608] (2 proteins)
    Pfam PF02575; DUF149; function unknown
  6. 880819Protein Hypothetical protein HI0442 [82609] (1 species)
  7. 880820Species Haemophilus influenzae [TaxId:727] [82610] (1 PDB entry)
  8. 880821Domain d1j8ba_: 1j8b A: [77101]
    structural genomics
    CASP4
    complexed with mse

Details for d1j8ba_

PDB Entry: 1j8b (more details), 1.75 Å

PDB Description: Structure of YbaB from Haemophilus influenzae (HI0442), a protein of unknown function
PDB Compounds: (A:) YbaB

SCOP Domain Sequences for d1j8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8ba_ d.222.1.1 (A:) Hypothetical protein HI0442 {Haemophilus influenzae [TaxId: 727]}
lgglmkqaqqmqekmqkmqeeiaqlevtgesgaglvkitingahncrrididpslmeddk
emledliaaafndavrraeelqkekmasvtag

SCOP Domain Coordinates for d1j8ba_:

Click to download the PDB-style file with coordinates for d1j8ba_.
(The format of our PDB-style files is described here.)

Timeline for d1j8ba_: