Lineage for d1j7nb2 (1j7n B:551-776)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 868142Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein)
  6. 868143Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
    duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain
  7. 868144Species Bacillus anthracis [TaxId:1392] [69777] (9 PDB entries)
  8. 868148Domain d1j7nb2: 1j7n B:551-776 [66413]
    Other proteins in same PDB: d1j7na3, d1j7nb3
    complexed with so4, zn

Details for d1j7nb2

PDB Entry: 1j7n (more details), 2.3 Å

PDB Description: Anthrax Toxin Lethal factor
PDB Compounds: (B:) Lethal Factor precursor

SCOP Domain Sequences for d1j7nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7nb2 d.92.1.14 (B:551-776) Anthrax toxin lethal factor, N- and C-terminal domains {Bacillus anthracis [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

SCOP Domain Coordinates for d1j7nb2:

Click to download the PDB-style file with coordinates for d1j7nb2.
(The format of our PDB-style files is described here.)

Timeline for d1j7nb2: