Lineage for d1j7db_ (1j7d B:)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (4 families) 
Family d.20.1.1: UBC-related [54496] (6 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species) 
Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (2 PDB entries) 
Domain d1j7db_: 1j7d B: [62681]
complexed with Mms2
Details for d1j7db_
PDB Entry: 1j7d (more details), 1.85 Å
PDB Description: Crystal Structure of hMms2-hUbc13
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2-17 kdaSCOP Domain Sequences for d1j7db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamn
SCOP Domain Coordinates for d1j7db_:
Click to download the PDB-style file with coordinates for d1j7db_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j7db_:
- d1j7db_ first appeared in SCOP 1.57
- d1j7db_ appears in SCOP 1.71
- d1j7db_ appears in SCOP 1.75
- d1j7db_ appears in the current release, SCOPe 2.08
View in 3D
