Lineage for d1j7da_ (1j7d A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (5 families) 
Family d.20.1.1: UBC-related [54496] (7 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) 
Species Human (Homo sapiens), mms2 [TaxId:9606] [64242] (6 PDB entries) 
Domain d1j7da_: 1j7d A: [62680]
complexed with ubc13
Details for d1j7da_
PDB Entry: 1j7d (more details), 1.85 Å
PDB Description: Crystal Structure of hMms2-hUbc13
PDB Compounds: (A:) mms2SCOPe Domain Sequences for d1j7da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7da_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), mms2 [TaxId: 9606]}
gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
mmskenmklpqppegqtynn
SCOPe Domain Coordinates for d1j7da_:
Click to download the PDB-style file with coordinates for d1j7da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j7da_:
- d1j7da_ first appeared in SCOP 1.57
- d1j7da_ appears in SCOPe 2.03
- d1j7da_ appears in SCOPe 2.05
- d1j7da_ appears in the current release, SCOPe 2.08
View in 3D
