Lineage for d1j75a_ (1j75 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983064Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
    Pfam PF02295
  6. 1983069Protein Dlm-1 [63486] (1 species)
  7. 1983070Species Mouse (Mus musculus) [TaxId:10090] [63487] (1 PDB entry)
  8. 1983071Domain d1j75a_: 1j75 A: [62673]
    protein/DNA complex

Details for d1j75a_

PDB Entry: 1j75 (more details), 1.85 Å

PDB Description: Crystal Structure of the DNA-Binding Domain Zalpha of DLM-1 Bound to Z-DNA
PDB Compounds: (A:) Tumor Stroma and Activated Macrophage Protein DLM-1

SCOPe Domain Sequences for d1j75a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j75a_ a.4.5.19 (A:) Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]}
nleqkilqvlsddggpvkigqlvkkcqvpkktlnqvlyrlkkedrvsspepatwsig

SCOPe Domain Coordinates for d1j75a_:

Click to download the PDB-style file with coordinates for d1j75a_.
(The format of our PDB-style files is described here.)

Timeline for d1j75a_: