Lineage for d1j6za1 (1j6z A:4-146)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this foldFamily c.55.1.1: Actin/HSP70 [53068] (8 proteins) 
Protein Actin [53073] (10 species) Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
Uniprot P02568 ! SQ 02568
Domain d1j6za1: 1j6z A:4-146 [62667]
complexed with adp, ca, rho
Details for d1j6za1
PDB Entry: 1j6z (more details), 1.54 Å
PDB Description: uncomplexed actin
PDB Compounds: (A:) actin alpha 1SCOPe Domain Sequences for d1j6za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j6za1 c.55.1.1 (A:4-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg
SCOPe Domain Coordinates for d1j6za1:
Click to download the PDB-style file with coordinates for d1j6za1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j6za1:
- d1j6za1 first appeared in SCOP 1.57
- d1j6za1 appears in SCOPe 2.06
- d1j6za1 appears in the current release, SCOPe 2.08
View in 3D
