Lineage for d1j6oa_ (1j6o A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1820872Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1821343Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (5 proteins)
    automatically mapped to Pfam PF01026
  6. 1821347Protein Hypothetical protein TM0667 [82268] (1 species)
  7. 1821348Species Thermotoga maritima [TaxId:2336] [82269] (1 PDB entry)
  8. 1821349Domain d1j6oa_: 1j6o A: [77088]
    complexed with ipa

Details for d1j6oa_

PDB Entry: 1j6o (more details), 1.8 Å

PDB Description: crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution
PDB Compounds: (A:) TatD-related deoxyribonuclease

SCOPe Domain Sequences for d1j6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]}
hhhhmvdthahlhfhqfdddrnavissfeenniefvvnvgvnledskksldlsktsdrif
csvgvhphdakevpedfiehlekfakdekvvaigetgldffrnispaevqkrvfveqiel
agklnlplvvhirdayseayeilrteslpekrgvihafssdyewakkfidlgfllgiggp
vtypknealrevvkrvgleyivletdcpflppqpfrgkrnepkylkyvvetisqvlgvpe
akvdeattenarriflevke

SCOPe Domain Coordinates for d1j6oa_:

Click to download the PDB-style file with coordinates for d1j6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1j6oa_: