| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) ![]() automatically mapped to Pfam PF00960 |
| Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins) |
| Protein Neocarzinostatin [49323] (1 species) |
| Species Streptomyces carzinostaticus [TaxId:1897] [49324] (7 PDB entries) |
| Domain d1j5ha_: 1j5h A: [77080] |
PDB Entry: 1j5h (more details)
SCOPe Domain Sequences for d1j5ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5ha_ b.1.7.1 (A:) Neocarzinostatin {Streptomyces carzinostaticus [TaxId: 1897]}
aaptatvtpssglsdgtvvkvagaglqagtaydvgqcawvdtgvlacnpadfssvtadan
gsastsltvrrsfegflfdgtrwgtvdcttaacqvglsdaagngpegvaisfn
Timeline for d1j5ha_: