![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein NTRC receiver domain [52180] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [52181] (8 PDB entries) |
![]() | Domain d1j56a_: 1j56 A: [90881] complexed with bef |
PDB Entry: 1j56 (more details)
SCOPe Domain Sequences for d1j56a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j56a_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais hyqe
Timeline for d1j56a_: