Lineage for d1j56a_ (1j56 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. Protein NTRC receiver domain [52180] (1 species)
  7. Species Salmonella typhimurium [TaxId:90371] [52181] (8 PDB entries)
  8. Domain d1j56a_: 1j56 A: [90881]
    complexed with bef

Details for d1j56a_

PDB Entry: 1j56 (more details)

PDB Description: minimized average structure of beryllofluoride-activated ntrc receiver domain: model structure incorporating active site contacts
PDB Compounds: (A:) nitrogen regulation protein nr(I)

SCOPe Domain Sequences for d1j56a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j56a_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]}
mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm
dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais
hyqe

SCOPe Domain Coordinates for d1j56a_ are not available.

Timeline for d1j56a_: